RetrogeneDB ID: | retro_ptro_2879 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 9:27264007..27264379(-) | ||
| Located in intron of: | ENSPTRG00000020831 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | H3F3C | ||
| Ensembl ID: | ENSPTRG00000009655 | ||
| Aliases: | None | ||
| Description: | Histone H3 [Source:UniProtKB/TrEMBL;Acc:G2HIR8] |
| Percent Identity: | 74.19 % |
| Parental protein coverage: | 91.18 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR |
| .A.TKQTA...TG.KA.RKQL.TKAA.KSAPS.G.VKKPH.YRPGTVAL.EI....KSTELL...LPF.. | |
| Retrocopy | VAPTKQTACTLTGDKASRKQLTTKAAYKSAPSPGVVKKPHCYRPGTVALHEISCFWKSTELLNHTLPFHG |
| Parental | LVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKD |
| L..EIAQDFK.D...QSAAIGAL.EASEAYLVGLFEDTNLCA.HAK..TIMPKD | |
| Retrocopy | LA*EIAQDFKSDQCVQSAAIGALREASEAYLVGLFEDTNLCAVHAKCITIMPKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 121 .81 RPM |
| SRP007412_cerebellum | 0 .11 RPM | 340 .56 RPM |
| SRP007412_heart | 0 .03 RPM | 83 .18 RPM |
| SRP007412_kidney | 0 .00 RPM | 177 .83 RPM |
| SRP007412_liver | 0 .13 RPM | 141 .18 RPM |
| SRP007412_testis | 0 .11 RPM | 690 .05 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4236 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000012702 | 10 retrocopies | |
| Equus caballus | ENSECAG00000006904 | 1 retrocopy | |
| Equus caballus | ENSECAG00000016948 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000004118 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000002139 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000008636 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000002045 | 20 retrocopies |
retro_ptro_1045, retro_ptro_1704, retro_ptro_1770, retro_ptro_1867, retro_ptro_1954, retro_ptro_2098, retro_ptro_2183, retro_ptro_2228, retro_ptro_2229, retro_ptro_2230, retro_ptro_2232, retro_ptro_2233, retro_ptro_2363, retro_ptro_279, retro_ptro_2834, retro_ptro_2936, retro_ptro_2978, retro_ptro_300, retro_ptro_3111, retro_ptro_3164,
|
| Pan troglodytes | ENSPTRG00000009655 | 12 retrocopies | |
| Tupaia belangeri | ENSTBEG00000016171 | 7 retrocopies |