RetrogeneDB ID: | retro_cpor_328 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_128:340452..340640(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SUMO3 | ||
Ensembl ID: | ENSCPOG00000025203 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 68.75 % |
Parental protein coverage: | 57.27 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | DGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQ-LEMEDEDTIDVFQ |
.GSV.Q.KI.R..PLSKLMKAYCER..LSMR.IR.RFDGQPINE.DT..Q..E...EDT.D.FQ | |
Retrocopy | EGSVIQLKINRQAPLSKLMKAYCERHSLSMR*IRLRFDGQPINEIDTSVQ<MELDGEDTSDEFQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 27 .84 RPM |
SRP017611_kidney | 0 .00 RPM | 28 .27 RPM |
SRP017611_liver | 0 .00 RPM | 22 .11 RPM |
SRP040447_lung | 0 .00 RPM | 54 .60 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 29 .68 RPM |