RetrogeneDB ID: | retro_dnov_1353 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_185758:3526..3687(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TXN | ||
Ensembl ID: | ENSDNOG00000019205 | ||
Aliases: | None | ||
Description: | thioredoxin [Source:HGNC Symbol;Acc:12435] |
Percent Identity: | 76.36 % |
Parental protein coverage: | 55.67 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | VVFLEVDVDD-CQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEATINELS |
V.FLE..VDD...DV.ADCEVKCMPTFQ.YKKGQ.VGEFSG.NKEK.E.TI.ELS | |
Retrocopy | VYFLEAHVDD<LSDVPADCEVKCMPTFQLYKKGQNVGEFSGVNKEKAETTISELS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 132 .43 RPM |
SRP012922_cerebellum | 0 .00 RPM | 39 .73 RPM |
SRP012922_heart | 0 .00 RPM | 51 .28 RPM |
SRP012922_kidney | 0 .00 RPM | 163 .73 RPM |
SRP012922_liver | 0 .00 RPM | 142 .11 RPM |
SRP012922_lung | 0 .15 RPM | 141 .73 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 47 .43 RPM |
SRP012922_spleen | 0 .00 RPM | 96 .15 RPM |