RetrogeneDB ID: | retro_dnov_843 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_11364:16766..16991(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TXN | ||
| Ensembl ID: | ENSDNOG00000019205 | ||
| Aliases: | None | ||
| Description: | thioredoxin [Source:HGNC Symbol;Acc:12435] |
| Percent Identity: | 64.0 % |
| Parental protein coverage: | 77.32 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | WCGPCKMIKPFFHSLSEKYSAVVFLEVDVDDCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEAT |
| WCGPCKMI.P.F.SLS.K....VFLEVD..DCQD........C...F.FYKK.QKVG.FSG.N.EKLEAT | |
| Retrocopy | WCGPCKMIRPLFNSLSVKNNNMVFLEVDIGDCQDLLQTEATACQHLFPFYKKAQKVGRFSGTNREKLEAT |
| Parental | INELS |
| I.ELS | |
| Retrocopy | ISELS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .19 RPM | 132 .43 RPM |
| SRP012922_cerebellum | 0 .41 RPM | 39 .73 RPM |
| SRP012922_heart | 0 .46 RPM | 51 .28 RPM |
| SRP012922_kidney | 0 .00 RPM | 163 .73 RPM |
| SRP012922_liver | 0 .77 RPM | 142 .11 RPM |
| SRP012922_lung | 0 .15 RPM | 141 .73 RPM |
| SRP012922_quadricep_muscle | 0 .17 RPM | 47 .43 RPM |
| SRP012922_spleen | 0 .23 RPM | 96 .15 RPM |