RetrogeneDB ID: | retro_cpor_1048 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_40:5007970..5008158(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCPOG00000015348 | ||
| Aliases: | None | ||
| Description: | Thioredoxin [Source:UniProtKB/TrEMBL;Acc:H0VT53] |
| Percent Identity: | 56.25 % |
| Parental protein coverage: | 60.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | FHSLSEKYSNVVFLEVDVDDCQDVAAECEVKCMPTFQFFKKGKKV-SEFSGANKEKLEATINEL |
| FHSL.EKY.N...LEVDVDDC...AA.C.VKCMPT..FFKKG.KV...F....K..L......L | |
| Retrocopy | FHSLTEKYYNLLLLEVDVDDCRVAAADCKVKCMPTLYFFKKGEKV<TSFLALKKKSLKSSLMNL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 23 .87 RPM |
| SRP017611_kidney | 0 .00 RPM | 72 .97 RPM |
| SRP017611_liver | 0 .00 RPM | 128 .40 RPM |
| SRP040447_lung | 0 .00 RPM | 65 .04 RPM |
| SRP040447_skeletal_muscle | 0 .01 RPM | 24 .32 RPM |