RetrogeneDB ID: | retro_mmul_840 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 11:8514721..8514960(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMMUG00000013088 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.95 % |
| Parental protein coverage: | 65.32 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | VRKFTEKHEWITTENGIGTVGISN-FAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSG |
| ..KFTEKHE.I.TENGI.TV.ISN.FAQ..LG.VVYCS.PEVGTKLNKQDEFGALES.KA..EL.SPLS. | |
| Retrocopy | LHKFTEKHECIITENGIVTVRISN<FAQRSLGAVVYCSRPEVGTKLNKQDEFGALESMKATNELFSPLS- |
| Parental | EVTEINEALAEN |
| E..E.N..L..N | |
| Retrocopy | ESLEENPELSTN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 8 .74 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .08 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 8 .78 RPM |
| SRP007412_heart | 0 .00 RPM | 7 .95 RPM |
| SRP007412_kidney | 0 .00 RPM | 27 .23 RPM |
| SRP007412_liver | 0 .00 RPM | 15 .64 RPM |
| SRP007412_testis | 0 .00 RPM | 37 .66 RPM |