RetrogeneDB ID: | retro_mmus_2243 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 3:41642837..41643020(-) | ||
| Located in intron of: | ENSMUSG00000059834 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rps21 | ||
| Ensembl ID: | ENSMUSG00000039001 | ||
| Aliases: | Rps21, 1810049N11Rik, 2410030A14Rik | ||
| Description: | ribosomal protein S21 [Source:MGI Symbol;Acc:MGI:1913731] |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 73.49 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | RIIAAKDHASIQMN-VAEVDRTTGRFNG-QFKTYGICGAIRRMGESDDSILRLAKADGIVSKN |
| ...A...H.SIQ...VAEVDR.TG.F...QFK.Y..CGAI.R.GESDDSIL.LAKADGIVSKN | |
| Retrocopy | QVFAVVCHTSIQVC>VAEVDRVTGKFDA<QFKPYILCGAIHRIGESDDSILLLAKADGIVSKN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .07 RPM | 91 .23 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 56 .40 RPM |
| SRP007412_heart | 0 .06 RPM | 82 .68 RPM |
| SRP007412_kidney | 0 .00 RPM | 73 .67 RPM |
| SRP007412_liver | 0 .05 RPM | 64 .53 RPM |
| SRP007412_testis | 0 .00 RPM | 35 .77 RPM |