RetrogeneDB ID: | retro_cfam_522 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 12:40207970..40208282(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS18 | ||
Ensembl ID: | ENSCAFG00000000950 | ||
Aliases: | None | ||
Description: | Canis lupus familiaris ribosomal protein S18 (RPS18), mRNA. [Source:RefSeq mRNA;Acc:NM_001048082] |
Percent Identity: | 62.39 % |
Parental protein coverage: | 70.39 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | ILRVLNTNID-GRRKIAFAITAIKGVGRRYAHVVLRKADID-LTKRAGELTEDEVERVITIMQNPRQYKI |
....LNTNI..G..KIAFAI.A.K.VG.RY..V.LR...ID..TKR....TEDEV..V.TIMQNP.QYKI | |
Retrocopy | LIYILNTNIC>GLLKIAFAIIASKVVGQRYSRVGLRNINID<FTKR---VTEDEV*LVTTIMQNPSQYKI |
Parental | PDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIR |
.D.F.NRQ.D.K.G.Y.QVLANGL.NKL..DLE.LKKI. | |
Retrocopy | TDCFWNRQSDMKYGNYMQVLANGLENKLYKDLEQLKKIQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 228 .26 RPM |
SRP017611_brain | 0 .00 RPM | 90 .43 RPM |
SRP017611_kidney | 0 .00 RPM | 675 .30 RPM |
SRP017611_liver | 0 .00 RPM | 191 .73 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000000950 | 7 retrocopies |
retro_cfam_1311, retro_cfam_1607, retro_cfam_2132, retro_cfam_414, retro_cfam_522 , retro_cfam_789, retro_cfam_856,
|
Dipodomys ordii | ENSDORG00000013825 | 6 retrocopies | |
Gorilla gorilla | ENSGGOG00000006571 | 5 retrocopies | |
Loxodonta africana | ENSLAFG00000032173 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000003867 | 1 retrocopy | |
Mus musculus | ENSMUSG00000008668 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000006840 | 10 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000010546 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000005854 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000025953 | 14 retrocopies | |
Pan troglodytes | ENSPTRG00000018039 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000028505 | 4 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000006857 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000008658 | 1 retrocopy |