RetrogeneDB ID: | retro_nleu_737 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397272.1:3850723..3851053(+) | ||
Located in intron of: | ENSNLEG00000004495 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS18 | ||
Ensembl ID: | ENSNLEG00000006840 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 86.36 % |
Parental protein coverage: | 62.86 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | VVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLE |
.VLRKADIDLTK.AGELTEDE.ERV.TIMQNP.QYKIPDWFLNRQKDVKDGKYSQVLA.GLD.KL..D.E | |
Retrocopy | MVLRKADIDLTKWAGELTEDEIERVMTIMQNPCQYKIPDWFLNRQKDVKDGKYSQVLASGLDKKLCADVE |
Parental | RLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK |
.LKKIRAHRGL.HFWGLRVRGQHTKTTG.RG.T.GVSKKK | |
Retrocopy | *LKKIRAHRGLHHFWGLRVRGQHTKTTGHRGCTMGVSKKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000000950 | 7 retrocopies | |
Dipodomys ordii | ENSDORG00000013825 | 6 retrocopies | |
Gorilla gorilla | ENSGGOG00000006571 | 5 retrocopies | |
Loxodonta africana | ENSLAFG00000032173 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000003867 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000014210 | 4 retrocopies | |
Mus musculus | ENSMUSG00000008668 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000006840 | 10 retrocopies |
retro_nleu_1074, retro_nleu_1161, retro_nleu_1176, retro_nleu_1466, retro_nleu_219, retro_nleu_2572, retro_nleu_2616, retro_nleu_525, retro_nleu_60, retro_nleu_737 ,
|
Oryctolagus cuniculus | ENSOCUG00000010546 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000005854 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000025953 | 14 retrocopies | |
Pan troglodytes | ENSPTRG00000018039 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000028505 | 4 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000006857 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000008658 | 1 retrocopy |