RetrogeneDB ID: | retro_cjac_2496 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 5:1352784..1353024(+) | ||
Located in intron of: | ENSCJAG00000017501 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7B | ||
Ensembl ID: | ENSCJAG00000004045 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase subunit VIIb [Source:HGNC Symbol;Acc:2291] |
Percent Identity: | 76.25 % |
Parental protein coverage: | 98.77 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MFPLVKNALSRLQVRSIQQTMARQSHQKRTPDFHDKYGNAILAGGATFCITMWTYVITQIGIEWNLSPVG |
MF.LVKNAL..LQV.SIQQTMARQSHQKRTPDF.DKY.NA.LA..ATFC...WTY..TQI.IE.NLS.VG | |
Retrocopy | MFHLVKNALRCLQVLSIQQTMARQSHQKRTPDFYDKYDNAVLASEATFCMALWTYRATQIRIERNLSSVG |
Parental | RVTPKEWRNQ |
R.TPKEWR.Q | |
Retrocopy | RITPKEWRDQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .44 RPM | 21 .43 RPM |
SRP051959_heart | 0 .12 RPM | 62 .41 RPM |
SRP051959_kidney | 0 .44 RPM | 40 .87 RPM |
SRP051959_liver | 0 .19 RPM | 40 .59 RPM |
SRP051959_lung | 0 .80 RPM | 12 .51 RPM |
SRP051959_lymph_node | 0 .87 RPM | 13 .08 RPM |
SRP051959_skeletal_muscle | 0 .17 RPM | 84 .12 RPM |
SRP051959_spleen | 0 .90 RPM | 20 .82 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2474 |
Pan troglodytes | retro_ptro_1431 |
Gorilla gorilla | retro_ggor_1539 |
Pongo abelii | retro_pabe_1824 |