RetrogeneDB ID: | retro_ggor_245 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 1:55844368..55844608(+) | ||
Located in intron of: | ENSGGOG00000000929 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7B | ||
Ensembl ID: | ENSGGOG00000023347 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 82.5 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | MFPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVG |
MF.LVK.A..RLQV.SIQQTMARQSH.KRTPDFHDKYG.AVLASG.TFCI..WT.VATQ..IEWNLSPVG | |
Retrocopy | MFLLVKTAPSRLQV*SIQQTMARQSHRKRTPDFHDKYGSAVLASGTTFCIAIWT*VATQIRIEWNLSPVG |
Parental | RVTPKEWRNQ |
RVTPKEWR.Q | |
Retrocopy | RVTPKEWRDQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .10 RPM | 25 .46 RPM |
SRP007412_cerebellum | 0 .08 RPM | 18 .28 RPM |
SRP007412_heart | 0 .06 RPM | 50 .28 RPM |
SRP007412_kidney | 0 .20 RPM | 105 .70 RPM |
SRP007412_liver | 0 .26 RPM | 43 .42 RPM |
SRP007412_testis | 0 .10 RPM | 9 .74 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_157 |
Pan troglodytes | retro_ptro_153 |
Pongo abelii | retro_pabe_465 |