RetrogeneDB ID: | retro_ggor_1617 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 22:19438237..19438478(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7B | ||
| Ensembl ID: | ENSGGOG00000023347 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 82.72 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MFPLVKNAL-NRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPV |
| MF.LVKNAL..RLQVRSIQQTMARQSHQK.TPDFHDKYGNAVLASGATFCI..WT.VATQ...EWNLSPV | |
| Retrocopy | MFLLVKNAL>SRLQVRSIQQTMARQSHQKCTPDFHDKYGNAVLASGATFCIAVWTSVATQIKMEWNLSPV |
| Parental | GRVTPKEWRNQ |
| .RVTPK.W..Q | |
| Retrocopy | SRVTPKGWIDQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .10 RPM | 25 .46 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 18 .28 RPM |
| SRP007412_heart | 0 .00 RPM | 50 .28 RPM |
| SRP007412_kidney | 0 .00 RPM | 105 .70 RPM |
| SRP007412_liver | 0 .05 RPM | 43 .42 RPM |
| SRP007412_testis | 0 .00 RPM | 9 .74 RPM |