RetrogeneDB ID: | retro_ggor_1617 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 22:19438237..19438478(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7B | ||
Ensembl ID: | ENSGGOG00000023347 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 82.72 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MFPLVKNAL-NRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPV |
MF.LVKNAL..RLQVRSIQQTMARQSHQK.TPDFHDKYGNAVLASGATFCI..WT.VATQ...EWNLSPV | |
Retrocopy | MFLLVKNAL>SRLQVRSIQQTMARQSHQKCTPDFHDKYGNAVLASGATFCIAVWTSVATQIKMEWNLSPV |
Parental | GRVTPKEWRNQ |
.RVTPK.W..Q | |
Retrocopy | SRVTPKGWIDQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .10 RPM | 25 .46 RPM |
SRP007412_cerebellum | 0 .00 RPM | 18 .28 RPM |
SRP007412_heart | 0 .00 RPM | 50 .28 RPM |
SRP007412_kidney | 0 .00 RPM | 105 .70 RPM |
SRP007412_liver | 0 .05 RPM | 43 .42 RPM |
SRP007412_testis | 0 .00 RPM | 9 .74 RPM |