RetrogeneDB ID: | retro_pabe_793 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 11:98670733..98670965(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7B | ||
Ensembl ID: | ENSPPYG00000020494 | ||
Aliases: | None | ||
Description: | Cytochrome c oxidase subunit 7B, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q5R9K2] |
Percent Identity: | 52.5 % |
Parental protein coverage: | 96.25 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 2 |
Parental | MFP-LVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWT-YVATQVGIEWNLSP |
MFP.L.KN.L....V.S..Q.....SHQK.TPD..D.Y.N.VLASGA.FCI..WT...AT..G..WNL.P | |
Retrocopy | MFP<LAKNTLSHFLVCSV*QITTKHSHQKHTPDCYDIYSNSVLASGANFCITVWT<ITAT*IGR*WNLPP |
Parental | VG-RVTPKEW |
.....TP.EW | |
Retrocopy | CW*NLTPNEW |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 35 .28 RPM |
SRP007412_cerebellum | 0 .00 RPM | 65 .66 RPM |
SRP007412_heart | 0 .00 RPM | 213 .64 RPM |
SRP007412_kidney | 0 .00 RPM | 74 .08 RPM |
SRP007412_liver | 0 .00 RPM | 45 .60 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_920 |
Macaca mulatta | retro_mmul_1120 |
Callithrix jacchus | retro_cjac_844 |