RetrogeneDB ID: | retro_ggor_579 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 10:60321096..60321335(-) | ||
Located in intron of: | ENSGGOG00000001347 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7B | ||
Ensembl ID: | ENSGGOG00000023347 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 62.96 % |
Parental protein coverage: | 98.75 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | FPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATF-CIVTWTYVATQVGIEWNLSPVG |
FPL.......L.V.SIQQTM.RQS.QK.T.DFHD.YGNA.LAS.A.F.....WTYVAT..GI.WNL.PV. | |
Retrocopy | FPLANGTVSNLGVQSIQQTMERQSRQKCTHDFHDRYGNAMLASRASF>LLPVWTYVATPIGIGWNLCPVA |
Parental | RVTPK-EWRNQ |
RVTP..EWR.Q | |
Retrocopy | RVTPN>EWRDQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .10 RPM | 25 .46 RPM |
SRP007412_cerebellum | 0 .00 RPM | 18 .28 RPM |
SRP007412_heart | 0 .00 RPM | 50 .28 RPM |
SRP007412_kidney | 0 .00 RPM | 105 .70 RPM |
SRP007412_liver | 0 .00 RPM | 43 .42 RPM |
SRP007412_testis | 0 .00 RPM | 9 .74 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_670 |
Pan troglodytes | retro_ptro_3014 |
Pongo abelii | retro_pabe_587 |
Macaca mulatta | retro_mmul_2400 |