RetrogeneDB ID: | retro_cjac_844 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 11:34944685..34944909(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7B | ||
Ensembl ID: | ENSCJAG00000004045 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase subunit VIIb [Source:HGNC Symbol;Acc:2291] |
Percent Identity: | 59.21 % |
Parental protein coverage: | 92.59 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | MFPLVKNALSRLQVRSIQQTMARQSHQKRTPDFHDKYGNAILAGGATFCITMWT-YVITQIGIEWNLSPV |
MFPL.K..LS..QV.SI.Q..A.QSHQK.TPD.HDKYG...LA.GA.FCIT.WT....T.IG..WNL... | |
Retrocopy | MFPLAKTTLSHFQV*SI*QIIAKQSHQKHTPDCHDKYGIDVLASGANFCITIWT<IRAT*IGR*WNLPSF |
Parental | GRVTPK |
GR..P. | |
Retrocopy | GRISPQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 21 .43 RPM |
SRP051959_heart | 0 .00 RPM | 62 .41 RPM |
SRP051959_kidney | 0 .00 RPM | 40 .87 RPM |
SRP051959_liver | 0 .00 RPM | 40 .59 RPM |
SRP051959_lung | 0 .00 RPM | 12 .51 RPM |
SRP051959_lymph_node | 0 .02 RPM | 13 .08 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 84 .12 RPM |
SRP051959_spleen | 0 .00 RPM | 20 .82 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_920 |
Pongo abelii | retro_pabe_793 |
Macaca mulatta | retro_mmul_1120 |