RetrogeneDB ID: | retro_pabe_836 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 12:38474379..38474613(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7B | ||
Ensembl ID: | ENSPPYG00000020494 | ||
Aliases: | None | ||
Description: | Cytochrome c oxidase subunit 7B, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q5R9K2] |
Percent Identity: | 64.56 % |
Parental protein coverage: | 98.75 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | FPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGR |
FPL.KN.L....V.SI.QT..RQSHQK..PDFHDKY.NAVLASGAT......TY..TQ.GI.W.LSPV.. | |
Retrocopy | FPLAKNELFCH*V*SIHQTITRQSHQKPIPDFHDKYRNAVLASGAT-PVYLCTYTSTQIGIQWKLSPVSK |
Parental | VTPKEWRNQ |
.TPKEW.NQ | |
Retrocopy | ATPKEWKNQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 35 .28 RPM |
SRP007412_cerebellum | 0 .00 RPM | 65 .66 RPM |
SRP007412_heart | 0 .00 RPM | 213 .64 RPM |
SRP007412_kidney | 0 .00 RPM | 74 .08 RPM |
SRP007412_liver | 0 .00 RPM | 45 .60 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_988 |
Pan troglodytes | retro_ptro_760 |
Macaca mulatta | retro_mmul_800 |