RetrogeneDB ID: | retro_ptro_349 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:141252785..141253025(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7B | ||
Ensembl ID: | ENSPTRG00000022049 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase subunit VIIb [Source:HGNC Symbol;Acc:2291] |
Percent Identity: | 77.5 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MFPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVG |
MFPLVKN.L.RL.V.SI.QTMARQSHQKRT.DFHDK.GNAVLASG.T.CI..WTYVATQ..I..NLSPVG | |
Retrocopy | MFPLVKNSLSRLHVPSIWQTMARQSHQKRTSDFHDKDGNAVLASGDTVCIAVWTYVATQIRIKGNLSPVG |
Parental | RVTPKEWRNQ |
RVT.K.WR.Q | |
Retrocopy | RVTLKKWRDQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 79 .65 RPM |
SRP007412_cerebellum | 0 .00 RPM | 29 .36 RPM |
SRP007412_heart | 0 .03 RPM | 221 .92 RPM |
SRP007412_kidney | 0 .00 RPM | 200 .35 RPM |
SRP007412_liver | 0 .00 RPM | 41 .41 RPM |
SRP007412_testis | 0 .00 RPM | 4 .85 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_462 |
Gorilla gorilla | retro_ggor_443 |
Pongo abelii | retro_pabe_270 |
Macaca mulatta | retro_mmul_571 |