RetrogeneDB ID: | retro_ggor_1539 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 20:33242606..33242845(-) | ||
Located in intron of: | ENSGGOG00000001674 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7B | ||
Ensembl ID: | ENSGGOG00000023347 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 79.01 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MFPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVG |
MFPLVKN.L..LQVRSIQQTMARQSHQK.TPDFH.KYGN.VLASG.TFCI..WTY..TQ.GIEWN.SPVG | |
Retrocopy | MFPLVKNKLSHLQVRSIQQTMARQSHQKHTPDFHNKYGNTVLASGPTFCIAMWTYITTQIGIEWNPSPVG |
Parental | RVTPK-EWRNQ |
RVTP...WR.Q | |
Retrocopy | RVTPQ<KWREQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 25 .46 RPM |
SRP007412_cerebellum | 0 .04 RPM | 18 .28 RPM |
SRP007412_heart | 0 .00 RPM | 50 .28 RPM |
SRP007412_kidney | 0 .04 RPM | 105 .70 RPM |
SRP007412_liver | 0 .03 RPM | 43 .42 RPM |
SRP007412_testis | 0 .10 RPM | 9 .74 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2474 |
Pan troglodytes | retro_ptro_1431 |
Pongo abelii | retro_pabe_1824 |
Callithrix jacchus | retro_cjac_2496 |