RetrogeneDB ID: | retro_pabe_1824 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 20:33095099..33095336(-) | ||
| Located in intron of: | ENSPPYG00000010964 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7B | ||
| Ensembl ID: | ENSPPYG00000020494 | ||
| Aliases: | None | ||
| Description: | Cytochrome c oxidase subunit 7B, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q5R9K2] |
| Percent Identity: | 81.01 % |
| Parental protein coverage: | 98.75 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MFPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVG |
| MFPLVKN.L..LQVRSIQQTMARQSHQKRTPDFH.KYGN.VLASGATFCI..WTY..TQ.GIEWN.SPVG | |
| Retrocopy | MFPLVKNKLSHLQVRSIQQTMARQSHQKRTPDFHNKYGNTVLASGATFCIAIWTYITTQIGIEWNPSPVG |
| Parental | RVTPKEWRN |
| RVTP....N | |
| Retrocopy | RVTPQNGKN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 35 .28 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 65 .66 RPM |
| SRP007412_heart | 0 .09 RPM | 213 .64 RPM |
| SRP007412_kidney | 0 .10 RPM | 74 .08 RPM |
| SRP007412_liver | 0 .06 RPM | 45 .60 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2474 |
| Pan troglodytes | retro_ptro_1431 |
| Gorilla gorilla | retro_ggor_1539 |
| Callithrix jacchus | retro_cjac_2496 |