RetrogeneDB ID: | retro_ptro_1714 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 2B:177791600..177791840(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7B | ||
Ensembl ID: | ENSPTRG00000022049 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase subunit VIIb [Source:HGNC Symbol;Acc:2291] |
Percent Identity: | 70. % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | MFPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVG |
MF.L.K.AL..LQV.S.Q.T.ARQSHQK.TPDFHDK.GNAV.AS..TFCI......ATQ.GIEWN.SPVG | |
Retrocopy | MFTLLKKALSHLQV*STQRTTARQSHQKHTPDFHDKHGNAV*ASETTFCIAVRICIATQTGIEWNMSPVG |
Parental | RVTPKEWRNQ |
RVTPKEWR.. | |
Retrocopy | RVTPKEWRDK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 79 .65 RPM |
SRP007412_cerebellum | 0 .00 RPM | 29 .36 RPM |
SRP007412_heart | 0 .03 RPM | 221 .92 RPM |
SRP007412_kidney | 0 .00 RPM | 200 .35 RPM |
SRP007412_liver | 0 .00 RPM | 41 .41 RPM |
SRP007412_testis | 0 .21 RPM | 4 .85 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2342 |
Gorilla gorilla | retro_ggor_1779 |
Pongo abelii | retro_pabe_2121 |
Callithrix jacchus | retro_cjac_2716 |