RetrogeneDB ID: retro_etel_190

Retrocopy location

• Organism: Lesser hedgehog tenrec (Echinops telfairi)
• Coordinates: GeneScaffold_3253:123477..123701(-)
• Located in intron of: ENSETEG00000000654

Retrocopy information

• Ensembl ID: None
• Aliases: None
• Status: NOVEL

Parental gene information

• Parental gene symbol: TOMM22
• Ensembl ID: ENSETEG00000000544
• Aliases: None
• Description: translocase of outer mitochondrial membrane 22 homolog (yeast) [Source:HGNC Symbol;Acc:18002]

Sequence

>retro_etel_190
AGAGTCCGGTCTGTGGCTGGAGCCACTTTTGATCTTTCCCTTTAAGTGGCTCAAAAAATGCACAGGTTTTCCAGGACAGC
CTCATAGATTCAGACCACTTCCTTGATGATTCTGATTCTCCCTGCCGTCTCTGAGACAGAGAAGTGGCAAATGCAGCAAC
AGCAGAACCTTCTAACAGCGGCAGATACTTCTTAGGACCCAACACAAAGCTGTTCGGGGGGGTA

Alignment

ORF - retro_etel_190 Open Reading Frame is not conserved.

Retrocopy - Parental Gene Alignment summary:

• Percent Identity: 71.05 %
• Parental protein coverage: 52.11 %
• Number of stop codons detected: 2
• Number of frameshifts detected: 2

Retrocopy - Parental Gene Alignment:

Parental  RVRSAAGATFDLSFFVAHKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQ-QRQIL-LGPNT
          RVRS.AGATFDLS..VA.KM.RFSR.A..I.TTS.MIL.LP.V.ETEK.QM.QQQ.L..QRQIL.LGPNT
Retrocopy RVRSVAGATFDLSL*VAQKMHRFSRTAS*IQTTSLMILILPAVSETEKWQMQQQQNLL>QRQIL>LGPNT

Parental  GLSGGL
          .L.GG.
Retrocopy KLFGGV

Legend:

• *: Stop codon
• >: Forward frameshift by one nucleotide
• <: Reverse frameshift by one nucleotide

Expression

RNA-Seq

Echinops telfairi was not studied using RNA-Seq expression data.

ChIP-Seq

Echinops telfairi was not studied using ChIP-Seq data.

EST

Echinops telfairi was not studied using EST data.

TSS

Echinops telfairi was not studied using FANTOM5 data.

Lab

retro_etel_190 was not experimentally validated.

Homology

Retrocopy orthology:

Echinops telfairi does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.

---

Parental genes homology:

Parental genes homology involve 23 parental genes, and 85 retrocopies.

Species	Parental gene accession	Retrocopies number
Ailuropoda melanoleuca	ENSAMEG00000010692	3 retrocopies	retro_amel_542, retro_amel_58, retro_amel_867,
Canis familiaris	ENSCAFG00000001383	2 retrocopies	retro_cfam_1817, retro_cfam_197,
Callithrix jacchus	ENSCJAG00000011731	5 retrocopies	retro_cjac_1220, retro_cjac_1230, retro_cjac_3675, retro_cjac_498, retro_cjac_94,
Cavia porcellus	ENSCPOG00000005963	1 retrocopy	retro_cpor_754,
Equus caballus	ENSECAG00000010359	1 retrocopy	retro_ecab_334,
Erinaceus europaeus	ENSEEUG00000006428	1 retrocopy	retro_eeur_29,
Echinops telfairi	ENSETEG00000000544	7 retrocopies	retro_etel_123, retro_etel_1477, retro_etel_154, retro_etel_1753, retro_etel_190 , retro_etel_2025, retro_etel_599,
Homo sapiens	ENSG00000100216	6 retrocopies	retro_hsap_1249, retro_hsap_2875, retro_hsap_3003, retro_hsap_4928, retro_hsap_633, retro_hsap_907,
Gorilla gorilla	ENSGGOG00000013230	4 retrocopies	retro_ggor_3084, retro_ggor_554, retro_ggor_734, retro_ggor_980,
Macropus eugenii	ENSMEUG00000002901	1 retrocopy	retro_meug_855,
Microcebus murinus	ENSMICG00000011792	3 retrocopies	retro_mmur_1549, retro_mmur_408, retro_mmur_892,
Myotis lucifugus	ENSMLUG00000003761	2 retrocopies	retro_mluc_2116, retro_mluc_543,
Macaca mulatta	ENSMMUG00000000364	8 retrocopies	retro_mmul_1020, retro_mmul_1113, retro_mmul_1459, retro_mmul_241, retro_mmul_2426, retro_mmul_2438, retro_mmul_2532, retro_mmul_498,
Mustela putorius furo	ENSMPUG00000013156	2 retrocopies	retro_mputfur_1038, retro_mputfur_1254,
Mus musculus	ENSMUSG00000022427	2 retrocopies	retro_mmus_1884, retro_mmus_2496,
Nomascus leucogenys	ENSNLEG00000015159	6 retrocopies	retro_nleu_2116, retro_nleu_2142, retro_nleu_2249, retro_nleu_375, retro_nleu_454, retro_nleu_617,
Otolemur garnettii	ENSOGAG00000029583	9 retrocopies	retro_ogar_1153, retro_ogar_1294, retro_ogar_1905, retro_ogar_2022, retro_ogar_2067, retro_ogar_214, retro_ogar_3111, retro_ogar_3328, retro_ogar_792,
Pongo abelii	ENSPPYG00000011825	6 retrocopies	retro_pabe_1041, retro_pabe_1088, retro_pabe_1968, retro_pabe_2489, retro_pabe_563, retro_pabe_782,
Pan troglodytes	ENSPTRG00000014374	6 retrocopies	retro_ptro_1583, retro_ptro_2031, retro_ptro_2117, retro_ptro_461, retro_ptro_627, retro_ptro_860,
Rattus norvegicus	ENSRNOG00000014058	4 retrocopies	retro_rnor_1323, retro_rnor_2280, retro_rnor_548, retro_rnor_549,
Sus scrofa	ENSSSCG00000000097	1 retrocopy	retro_sscr_310,
Tupaia belangeri	ENSTBEG00000015683	4 retrocopies	retro_tbel_1810, retro_tbel_2901, retro_tbel_2922, retro_tbel_3041,
Vicugna pacos	ENSVPAG00000001485	1 retrocopy	retro_vpac_586,