RetrogeneDB ID: | retro_ggor_1666 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 2a:20898159..20898491(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS25 | ||
Ensembl ID: | ENSGGOG00000025540 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 76.79 % |
Parental protein coverage: | 88.8 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MPPKDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITP |
.PPKD.KKKKDAGK.A.KDKDPV.KSG.KAKKKK.SK..VRDK.NNLVLFDK.T.DK.CKEVPN.KLITP | |
Retrocopy | IPPKDKKKKKDAGKLARKDKDPVSKSGDKAKKKKCSKDIVRDKPNNLVLFDKTT*DKPCKEVPNCKLITP |
Parental | AVVSERLKIRGSLARAA-LQELLSKGLIKLVSKHRAQVIYTR |
A.VSERLKI..SLARAA.LQELLSKGLIKLVSK......Y.. | |
Retrocopy | AMVSERLKI*VSLARAA<LQELLSKGLIKLVSKQSSSNLYQK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .19 RPM | 88 .09 RPM |
SRP007412_cerebellum | 0 .32 RPM | 94 .56 RPM |
SRP007412_heart | 0 .03 RPM | 69 .29 RPM |
SRP007412_kidney | 0 .08 RPM | 235 .11 RPM |
SRP007412_liver | 0 .00 RPM | 215 .01 RPM |
SRP007412_testis | 0 .00 RPM | 199 .02 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2233 |
Pan troglodytes | retro_ptro_1579 |
Pongo abelii | retro_pabe_1971 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000027772 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000013691 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000007880 | 7 retrocopies | |
Homo sapiens | ENSG00000118181 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000025540 | 7 retrocopies |
retro_ggor_1601, retro_ggor_1666 , retro_ggor_1979, retro_ggor_2395, retro_ggor_2880, retro_ggor_337, retro_ggor_634,
|
Mus musculus | ENSMUSG00000009927 | 15 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000017256 | 11 retrocopies | |
Otolemur garnettii | ENSOGAG00000007265 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000025915 | 6 retrocopies | |
Sorex araneus | ENSSARG00000002284 | 4 retrocopies | |
Tupaia belangeri | ENSTBEG00000010244 | 16 retrocopies | |
Tarsius syrichta | ENSTSYG00000005422 | 15 retrocopies |