RetrogeneDB ID: | retro_pabe_3507 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 9:119880191..119880565(-) | ||
Located in intron of: | ENSPPYG00000019586 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS25 | ||
Ensembl ID: | ENSPPYG00000025915 | ||
Aliases: | None | ||
Description: | ribosomal protein S25 [Source:HGNC Symbol;Acc:10413] |
Percent Identity: | 88.89 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MPPKDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNL-VLFDKATYDKLCKEVPNYKLIT |
MPPKD.KKKKD.GKSAKKDKD..NK.GGKAKKKKWSKGKVRDKLN.L.VLFD.ATYDKLCK.VPNYKL.T | |
Retrocopy | MPPKDYKKKKDTGKSAKKDKDSLNKPGGKAKKKKWSKGKVRDKLNTL<VLFDEATYDKLCK*VPNYKLTT |
Parental | PAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA |
PAVVS.RLKI.GSLARAAL.ELLSKGLIKLVSKHRAQVIYTRNTKG.DAPAAGEDA | |
Retrocopy | PAVVSKRLKI*GSLARAALLELLSKGLIKLVSKHRAQVIYTRNTKGRDAPAAGEDA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 63 .53 RPM |
SRP007412_cerebellum | 0 .24 RPM | 76 .24 RPM |
SRP007412_heart | 0 .03 RPM | 100 .58 RPM |
SRP007412_kidney | 0 .00 RPM | 140 .58 RPM |
SRP007412_liver | 0 .03 RPM | 145 .20 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4310 |
Pan troglodytes | retro_ptro_2918 |
Gorilla gorilla | retro_ggor_2880 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000027772 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000013691 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000007880 | 7 retrocopies | |
Homo sapiens | ENSG00000118181 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000025540 | 7 retrocopies | |
Latimeria chalumnae | ENSLACG00000017531 | 4 retrocopies | |
Macropus eugenii | ENSMEUG00000014185 | 3 retrocopies | |
Mus musculus | ENSMUSG00000009927 | 15 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000017256 | 11 retrocopies | |
Otolemur garnettii | ENSOGAG00000007265 | 3 retrocopies | |
Ochotona princeps | ENSOPRG00000016194 | 9 retrocopies | |
Pongo abelii | ENSPPYG00000025915 | 6 retrocopies | |
Sorex araneus | ENSSARG00000002284 | 4 retrocopies | |
Tupaia belangeri | ENSTBEG00000010244 | 16 retrocopies | |
Tarsius syrichta | ENSTSYG00000005422 | 15 retrocopies | |
Vicugna pacos | ENSVPAG00000000266 | 4 retrocopies |