RetrogeneDB ID: | retro_ocun_856 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 16:15619950..15620297(+) | ||
Located in intron of: | ENSOCUG00000004961 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS25 | ||
Ensembl ID: | ENSOCUG00000017256 | ||
Aliases: | None | ||
Description: | ribosomal protein S25 [Source:HGNC Symbol;Acc:10413] |
Percent Identity: | 59.66 % |
Parental protein coverage: | 92. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 4 |
Parental | KDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLN-NLVLFDKATYDKLCKEVPNYKLITPAVVSERLK |
KD..K.....K.PVNKS.G.AKKK...KG.V.DKL...LVLFD.A...KLCK.VPN.KL...AVV...LK | |
Retrocopy | KDDKKKVGQLKEPVNKSRGEAKKKRQPKGRVPDKLS>SLVLFDRAI*NKLCKAVPN*KLRVLAVVFDSLK |
Parental | IRG-SLARAALQELL-SKGLIKLVSKHRAQVIYTRNTKGGDA-PAAGED |
.....L.R.ALQELL..KGL..LVSK.RAQVI.TRNTK.....PAAGED | |
Retrocopy | VLS>FLFRVALQELL<GKGLKQLVSKQRAQVIHTRNTKAEGI>PAAGED |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 91 .94 RPM |
SRP017611_kidney | 0 .00 RPM | 219 .64 RPM |
SRP017611_liver | 0 .00 RPM | 69 .44 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000027772 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000013691 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000007880 | 7 retrocopies | |
Homo sapiens | ENSG00000118181 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000025540 | 7 retrocopies | |
Latimeria chalumnae | ENSLACG00000017531 | 4 retrocopies | |
Macropus eugenii | ENSMEUG00000014185 | 3 retrocopies | |
Mus musculus | ENSMUSG00000009927 | 15 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000017256 | 11 retrocopies | |
Otolemur garnettii | ENSOGAG00000007265 | 3 retrocopies | |
Ochotona princeps | ENSOPRG00000016194 | 9 retrocopies | |
Pongo abelii | ENSPPYG00000025915 | 6 retrocopies | |
Pan troglodytes | ENSPTRG00000004361 | 10 retrocopies | |
Sorex araneus | ENSSARG00000002284 | 4 retrocopies | |
Tupaia belangeri | ENSTBEG00000010244 | 16 retrocopies | |
Tarsius syrichta | ENSTSYG00000005422 | 15 retrocopies | |
Vicugna pacos | ENSVPAG00000000266 | 4 retrocopies |