RetrogeneDB ID: | retro_pabe_1164 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 14:41531895..41532128(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2D2 | ||
Ensembl ID: | ENSPPYG00000015844 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2D 2 [Source:HGNC Symbol;Acc:12475] |
Percent Identity: | 69.62 % |
Parental protein coverage: | 53.06 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | ELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPK-VAFTTRIYHPN |
.L.DLA.D.P.Q.SAGP.GDDMFHWQATIM.PN.SPY...VF.L.IHFP.DYPFKP...VA...RIY..N | |
Retrocopy | KLSDLAHDLPTQRSAGPAGDDMFHWQATIMEPNNSPY*DYVFLLKIHFPIDYPFKPMR<VALRKRIYQTN |
Parental | INSNGSICL |
INSN.SICL | |
Retrocopy | INSNDSICL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 23 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 17 .27 RPM |
SRP007412_heart | 0 .00 RPM | 13 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 16 .57 RPM |
SRP007412_liver | 0 .00 RPM | 11 .93 RPM |
Species | RetrogeneDB ID |
---|---|
Callithrix jacchus | retro_cjac_791 |