RetrogeneDB ID: | retro_ptro_2918 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 9:122074169..122074543(-) | ||
| Located in intron of: | ENSPTRG00000021342 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS25 | ||
| Ensembl ID: | ENSPTRG00000004361 | ||
| Aliases: | None | ||
| Description: | Pan troglodytes ribosomal protein S25 (RPS25), mRNA. [Source:RefSeq mRNA;Acc:NM_001251993] |
| Percent Identity: | 90.48 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MPPKDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNL-VLFDKATYDKLCKEVPNYKLIT |
| MPPKD.KKK.D.GKSAKKDKDPVNK.GGKAKKKKWSKGKVRDKLN.L.VLFDKATYDKLCKEVPNYKL.T | |
| Retrocopy | MPPKDYKKKTDTGKSAKKDKDPVNKPGGKAKKKKWSKGKVRDKLNTL<VLFDKATYDKLCKEVPNYKLVT |
| Parental | PAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA |
| P.VVS.RLKI.GSLARAAL.ELLSKGLIKLVSKHRAQVIYTRNTKG.DAPAAGEDA | |
| Retrocopy | PVVVSKRLKI*GSLARAALLELLSKGLIKLVSKHRAQVIYTRNTKGRDAPAAGEDA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .07 RPM | 64 .85 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 55 .74 RPM |
| SRP007412_heart | 0 .03 RPM | 84 .12 RPM |
| SRP007412_kidney | 0 .00 RPM | 127 .65 RPM |
| SRP007412_liver | 0 .00 RPM | 95 .88 RPM |
| SRP007412_testis | 0 .00 RPM | 59 .75 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4310 |
| Gorilla gorilla | retro_ggor_2880 |
| Pongo abelii | retro_pabe_3507 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000027772 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000013691 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007880 | 7 retrocopies | |
| Mus musculus | ENSMUSG00000009927 | 15 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017256 | 11 retrocopies | |
| Otolemur garnettii | ENSOGAG00000007265 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000004361 | 10 retrocopies |
retro_ptro_1368, retro_ptro_1494, retro_ptro_1579, retro_ptro_1722, retro_ptro_1935, retro_ptro_2291, retro_ptro_2411, retro_ptro_245, retro_ptro_2918 , retro_ptro_536,
|
| Sorex araneus | ENSSARG00000002284 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000010244 | 16 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005422 | 15 retrocopies |