RetrogeneDB ID: | retro_sscr_894 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 7:11818881..11819258(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSSSCG00000001060 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HINT1 | ||
Ensembl ID: | ENSSSCG00000014264 | ||
Aliases: | None | ||
Description: | histidine triad nucleotide binding protein 1 [Source:HGNC Symbol;Acc:4912] |
Percent Identity: | 79.53 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MADEIAKAQAARPGGDTIFGKIIRKEIPAKIIYEDDQCLAFHDISPQAPTHFLVIPKKHISQI-SAAEDD |
MAD.IAKAQAA.PGGDTIFGK.I.KE.PAKI..ED.QCLAFHDISP.APTHFL.I.KK..SQI.SAAEDD | |
Retrocopy | MADGIAKAQAAGPGGDTIFGKVIGKEMPAKIASEDAQCLAFHDISPRAPTHFLAIAKKCTSQI<SAAEDD |
Parental | DESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG |
.ESLLGH.M.VGKKCAADLGLK.G....V.EGSDGGQSVYHVH.HVLGG.QM.WPPG | |
Retrocopy | GESLLGH*MMVGKKCAADLGLKEGLSDGVMEGSDGGQSVYHVHRHVLGGGQMDWPPG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 62 .78 RPM |
SRP014902_testis | 0 .00 RPM | 80 .20 RPM |
SRP018288_heart | 0 .00 RPM | 100 .69 RPM |
SRP018288_kidney | 0 .00 RPM | 254 .74 RPM |
SRP018288_liver | 0 .00 RPM | 238 .43 RPM |
SRP018288_lung | 0 .00 RPM | 65 .98 RPM |
SRP018856_adipose | 0 .00 RPM | 126 .44 RPM |
SRP035408_brain | 0 .00 RPM | 283 .78 RPM |
SRP035408_liver | 0 .00 RPM | 92 .32 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017774 | 4 retrocopies | |
Bos taurus | ENSBTAG00000010959 | 5 retrocopies | |
Canis familiaris | ENSCAFG00000032152 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000014398 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000010127 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011967 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000005368 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000001091 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000028727 | 3 retrocopies | |
Mustela putorius furo | ENSMPUG00000011639 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000006607 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000000622 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000005834 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000014264 | 2 retrocopies |
retro_sscr_371, retro_sscr_894 ,
|
Ictidomys tridecemlineatus | ENSSTOG00000027920 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000008653 | 4 retrocopies |