RetrogeneDB ID: | retro_ggor_667 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 11:92550724..92550955(+) | ||
| Located in intron of: | ENSGGOG00000004922 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ENSG00000105193 | ||
| Ensembl ID: | ENSGGOG00000014414 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 70.13 % |
| Parental protein coverage: | 51.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | LLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR |
| LLLGKE.FAGVDI.V.VK..GHV.QI.AI.Q..SK.LVAY.QKYV.EASKK.IKDILIQYD..LL.ADP. | |
| Retrocopy | LLLGKEWFAGVDICVYVKSSGHVPQIWAIQQYVSKSLVAYCQKYVNEASKKQIKDILIQYDWILLIADPL |
| Parental | RCESKKF |
| ...SK.. | |
| Retrocopy | AANSKSW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 130 .91 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 163 .15 RPM |
| SRP007412_heart | 0 .03 RPM | 136 .65 RPM |
| SRP007412_kidney | 0 .00 RPM | 339 .46 RPM |
| SRP007412_liver | 0 .00 RPM | 456 .55 RPM |
| SRP007412_testis | 0 .00 RPM | 197 .15 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_813 |
| Pan troglodytes | retro_ptro_565 |
| Macaca mulatta | retro_mmul_1080 |
| Callithrix jacchus | retro_cjac_905 |