RetrogeneDB ID: | retro_ogar_809 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873528.1:21281457..21281696(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL28 | ||
| Ensembl ID: | ENSOGAG00000025533 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L28 [Source:HGNC Symbol;Acc:10330] |
| Percent Identity: | 56.79 % |
| Parental protein coverage: | 56.93 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | DGKGVVVVMKRRSGQRKPATSYVRTTINKNARA-TLSSIRHMIRKNKYRPD--LRMAAIRRASAILRSQK |
| .GKGV..V.K.RSGQ..P..SY..TTINK...A..LSSIRH....N.Y..D..L.MAA..RA.A.L.SQ. | |
| Retrocopy | EGKGVRAVLK*RSGQGQPDISYMWTTINKYTWA<PLSSIRHTMPQNRYQLDLGLHMAALCRANAVLHSQE |
| Parental | PVMVKRKRTRH |
| PV.VKRK.T.H | |
| Retrocopy | PVRVKRKHTAH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |