RetrogeneDB ID: | retro_pcap_228 | ||
Retrocopy location | Organism: | Hyrax (Procavia capensis) | |
| Coordinates: | scaffold_194007:1616..1858(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL31 | ||
| Ensembl ID: | ENSPCAG00000004787 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L31 [Source:HGNC Symbol;Acc:10334] |
| Percent Identity: | 52.44 % |
| Parental protein coverage: | 64.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | KGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRID-TRLNKAVWAKGIRNV |
| K..SAINEVV.R...I...K..HG.GFK.....AL..I..FAMKEMGT.....D..R.NKAV.AKG.... | |
| Retrocopy | KDHSAINEVVIR*NSIRFQKCVHGPGFK*HVSQALNQIETFAMKEMGTQHGHTD>IRVNKAVLAKGTKSQ |
| Parental | -PYRIRVRLSRK |
| ..YR..V.LSRK | |
| Retrocopy | >EYRLFVLLSRK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |