RetrogeneDB ID: | retro_btau_1710 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 9:78159330..78159522(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA4 | ||
Ensembl ID: | ENSBTAG00000011145 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4 [Source:UniProtKB/Swiss-Prot;Acc:Q01321] |
Percent Identity: | 76.56 % |
Parental protein coverage: | 78.05 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | FIFIGAGGTGAALYVTRLALFNPDVSWDRKNNPEPWNKLGPNDQYKFYSVNVDYSKLKKEGPDF |
FIF.GAGGTGA.L.V..LALFN.DV....KNNPEPWN.L.PNDQYKFYSV.VDY.KL.KEGPDF | |
Retrocopy | FIFTGAGGTGATLHVLHLALFNCDVR*AKKNNPEPWNQLDPNDQYKFYSVKVDYRKLNKEGPDF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 155 .87 RPM |
ERP005899_muscle | 0 .00 RPM | 125 .90 RPM |
SRP017611_brain | 0 .00 RPM | 75 .65 RPM |
SRP017611_kidney | 0 .00 RPM | 195 .66 RPM |
SRP017611_liver | 0 .00 RPM | 64 .94 RPM |
SRP030211_testis | 0 .01 RPM | 24 .87 RPM |