RetrogeneDB ID: | retro_vpac_262 | ||
Retrocopy location | Organism: | Alpaca (Vicugna pacos) | |
| Coordinates: | GeneScaffold_3436:613245..613473(+) | ||
| Located in intron of: | ENSVPAG00000007150 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4 | ||
| Ensembl ID: | ENSVPAG00000010003 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687] |
| Percent Identity: | 73.68 % |
| Parental protein coverage: | 92.68 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MFRHIVGQAKKHPSLIPLFLFIGGGGTGAVLYVLRLAMFNPDVSWDRKNNPEPWNKLGPNEQYKFYSVNV |
| ..R.I.G.AKKHPSL..LF..IG.G..GA.LYVLRLA.F.PDVSWDRKNNPEPW.KLGP..QYKFYSV.. | |
| Retrocopy | ILRQIIG*AKKHPSLTLLFICIGVGSPGAMLYVLRLALFSPDVSWDRKNNPEPWDKLGPSDQYKFYSVTI |
| Parental | DYSKLK |
| DYSKLK | |
| Retrocopy | DYSKLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |