RetrogeneDB ID: | retro_fcat_449 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | A3:110696838..110696992(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4 | ||
| Ensembl ID: | ENSFCAG00000024790 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687] |
| Percent Identity: | 75.93 % |
| Parental protein coverage: | 63.41 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | LYVLRLALFNPDVSWDRKNNPEP-WNKLGPNDQYKFYSVNVD-YSKLKKEGPDF |
| LY.L.LALF.P.V..DRK.NPEP.WNKLGP.DQY..YSVNVD.YSKLKK.GPDF | |
| Retrocopy | LYILYLALFIPGVG*DRKYNPEP<WNKLGPSDQYRVYSVNVD<YSKLKKGGPDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 125 .91 RPM |
| SRP017611_kidney | 0 .00 RPM | 136 .55 RPM |
| SRP017611_liver | 0 .00 RPM | 72 .68 RPM |