RetrogeneDB ID: | retro_ecab_370 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 16:4770383..4770614(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4 | ||
| Ensembl ID: | ENSECAG00000026987 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687] |
| Percent Identity: | 81.82 % |
| Parental protein coverage: | 96.25 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | RHILGQAKKHPSLIPLFIFIGAGGTGAALYVLRLAMFNPDVSWDRKNNPEPWNKLGPNDQYKFFSVNVDY |
| R.IL..AKKHPSLIPLFIF.GA.G.GA.L.VL..A.FNPDVSWDRKNNPEPWNK.GP.DQYK.FSVNVDY | |
| Retrocopy | RPILTPAKKHPSLIPLFIFLGARGAGAPLCVLCPAVFNPDVSWDRKNNPEPWNKPGPSDQYKLFSVNVDY |
| Parental | SKLKKEG |
| SKLKKEG | |
| Retrocopy | SKLKKEG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 4 .43 RPM |
| SRP021940_cerebellum | 0 .73 RPM | 79 .72 RPM |
| SRP021940_embryo | 1 .53 RPM | 34 .60 RPM |
| SRP021940_placental_villous | 0 .48 RPM | 58 .36 RPM |
| SRP021940_synovial_membrane | 0 .47 RPM | 17 .24 RPM |
| SRP021940_testis | 0 .06 RPM | 31 .65 RPM |