RetrogeneDB ID: | retro_mmus_3620 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:57631708..57631954(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000081100 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ndufa4 | ||
| Ensembl ID: | ENSMUSG00000029632 | ||
| Aliases: | Ndufa4, MLRQ | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4 [Source:MGI Symbol;Acc:MGI:107686] |
| Percent Identity: | 91.46 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MLRQILGQAKKHPSLIPLFVFIGAGGTGAALYVMRLALFNPDVSWDRKNNPEPWNKLGPNEQYKFYSVNV |
| MLRQI.GQAKKHPSLI.LF.FIGAGGTGAAL.VMRLALFNPDV.WDRKNNPEPWNKLGPNEQ.KFYSV.V | |
| Retrocopy | MLRQIIGQAKKHPSLISLFIFIGAGGTGAALCVMRLALFNPDVTWDRKNNPEPWNKLGPNEQ*KFYSVIV |
| Parental | DYSKLKKEGPDF |
| DYSKLKKEGPDF | |
| Retrocopy | DYSKLKKEGPDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 138 .24 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 158 .23 RPM |
| SRP007412_heart | 0 .00 RPM | 481 .55 RPM |
| SRP007412_kidney | 0 .04 RPM | 350 .73 RPM |
| SRP007412_liver | 0 .00 RPM | 195 .50 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .87 RPM |