RetrogeneDB ID: | retro_sscr_733 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 3:76290150..76290333(-) | ||
| Located in intron of: | ENSSSCG00000008337 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4 | ||
| Ensembl ID: | ENSSSCG00000024313 | ||
| Aliases: | None | ||
| Description: | Sus scrofa NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa (NDUFA4), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001097468] |
| Percent Identity: | 72.13 % |
| Parental protein coverage: | 74.39 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MLRQIITQAKKHPSLIPLFVFIGAGGTGAALYVTRLALFNPDVCWDRKNNPEPWNKLGPND |
| M..QII.QAKK.PSL.P..V..GAG.TGA..YV..LA.FNPDV.W.RKNNPEPWNKLGPND | |
| Retrocopy | MFCQIISQAKKPPSLPPVSVSTGAGSTGATWYVMCLAMFNPDVSWERKNNPEPWNKLGPND |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 58 .14 RPM |
| SRP014902_testis | 0 .14 RPM | 36 .92 RPM |
| SRP018288_heart | 0 .00 RPM | 841 .08 RPM |
| SRP018288_kidney | 0 .00 RPM | 371 .66 RPM |
| SRP018288_liver | 0 .00 RPM | 173 .98 RPM |
| SRP018288_lung | 0 .00 RPM | 54 .17 RPM |
| SRP018856_adipose | 0 .20 RPM | 76 .74 RPM |
| SRP035408_brain | 0 .03 RPM | 162 .36 RPM |
| SRP035408_liver | 0 .00 RPM | 105 .92 RPM |