RetrogeneDB ID: | retro_ggor_1642 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 2a:73640497..73640719(+) | ||
Located in intron of: | ENSGGOG00000000465 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS15A | ||
Ensembl ID: | ENSGGOG00000026299 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 81.08 % |
Parental protein coverage: | 56.92 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | KRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEK |
KRGK...LIR.CSKVIV.FLTV..KHGYIGEF.II..HRAGKI.VNLT.RLNKCGVIS.RF.VQLKDLEK | |
Retrocopy | KRGKCHILIRLCSKVIVQFLTVLLKHGYIGEFKIIENHRAGKIIVNLTSRLNKCGVISTRFAVQLKDLEK |
Parental | WQNN |
WQNN | |
Retrocopy | WQNN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 45 .56 RPM |
SRP007412_cerebellum | 0 .00 RPM | 56 .77 RPM |
SRP007412_heart | 0 .00 RPM | 48 .53 RPM |
SRP007412_kidney | 0 .00 RPM | 183 .39 RPM |
SRP007412_liver | 0 .00 RPM | 220 .31 RPM |
SRP007412_testis | 0 .00 RPM | 121 .21 RPM |