RetrogeneDB ID: | retro_ggor_466 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 1:192953378..192953597(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS15A | ||
Ensembl ID: | ENSGGOG00000026299 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 82.19 % |
Parental protein coverage: | 56.15 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | NAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKD |
NA.KR...QVLIR.CSKV.V.FLTVMMKHGYIGEF..IDDHRAGKIVVNL.GRLNKCG.IS.RFDVQ.KD | |
Retrocopy | NAKKRPTCQVLIRSCSKVMVWFLTVMMKHGYIGEFKVIDDHRAGKIVVNLIGRLNKCGAISSRFDVQFKD |
Parental | LEK |
LEK | |
Retrocopy | LEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 45 .56 RPM |
SRP007412_cerebellum | 0 .00 RPM | 56 .77 RPM |
SRP007412_heart | 0 .00 RPM | 48 .53 RPM |
SRP007412_kidney | 0 .00 RPM | 183 .39 RPM |
SRP007412_liver | 0 .00 RPM | 220 .31 RPM |
SRP007412_testis | 0 .00 RPM | 121 .21 RPM |