RetrogeneDB ID: | retro_pvam_1132 | ||
Retrocopy location | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | scaffold_3156:123470..123710(-) | ||
| Located in intron of: | ENSPVAG00000017895 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS15A | ||
| Ensembl ID: | ENSPVAG00000002901 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S15a [Source:HGNC Symbol;Acc:10389] |
| Percent Identity: | 63.75 % |
| Parental protein coverage: | 61.54 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | EIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH |
| .........KIVVNL.G..NK..VIS.RFDVQLK.LEKWQNNLLP....GF.V.T.S..IMDHEEA..KH | |
| Retrocopy | DTLNKNYRAKIVVNLMGG*NKYEVISSRFDVQLKHLEKWQNNLLPFC*SGFTVVTISVDIMDHEEAS*KH |
| Parental | TGGKILGFFF |
| .GGKIL.FFF | |
| Retrocopy | MGGKILRFFF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |