RetrogeneDB ID: | retro_mmus_875 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 12:79216277..79216526(+) | ||
| Located in intron of: | ENSMUSG00000021123 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ube2d3 | ||
| Ensembl ID: | ENSMUSG00000078578 | ||
| Aliases: | Ube2d3, 1100001F19Rik, 9430029A22Rik, AA414951 | ||
| Description: | ubiquitin-conjugating enzyme E2D 3 [Source:MGI Symbol;Acc:MGI:1913355] |
| Percent Identity: | 53.49 % |
| Parental protein coverage: | 57.14 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | LKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPF-KPPKVAFTT |
| LKRINKELSDL...PP.QC..G......F..QA.I..PN.S.YQ.......I.FP....F..P.K.AFTT | |
| Retrocopy | LKRINKELSDLVHNPPPQCPTGQL-RIIFF*QAIIKQPNGSLYQTVXXXXPIYFPMVPSF>QPAKDAFTT |
| Parental | R-IYHPNINSNGSICL |
| R.IYH.N.N.NG.ICL | |
| Retrocopy | R<IYHSNVNRNGIICL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 96 .68 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 65 .26 RPM |
| SRP007412_heart | 0 .00 RPM | 135 .32 RPM |
| SRP007412_kidney | 0 .00 RPM | 106 .26 RPM |
| SRP007412_liver | 0 .00 RPM | 106 .78 RPM |
| SRP007412_testis | 0 .00 RPM | 71 .76 RPM |