RetrogeneDB ID: | retro_btau_566 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 14:71899050..71899266(-) | ||
| Located in intron of: | ENSBTAG00000013621 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL22 | ||
| Ensembl ID: | ENSBTAG00000014423 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L22 [Source:HGNC Symbol;Acc:10315] |
| Percent Identity: | 82.19 % |
| Parental protein coverage: | 57.03 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | TLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTSEVPFSKRYLKYLTKKYL |
| .L..THP.EDGI..AA.FEQFLQERIKVN.KAGNLGG.VV..ERSKSKITVTSEVPFSK.YLKYLTKKYL | |
| Retrocopy | SLHYTHPAEDGILGAADFEQFLQERIKVNRKAGNLGG-VVIVERSKSKITVTSEVPFSKMYLKYLTKKYL |
| Parental | KKN |
| K.N | |
| Retrocopy | KNN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .07 RPM | 159 .62 RPM |
| ERP005899_muscle | 0 .00 RPM | 241 .46 RPM |
| SRP017611_brain | 0 .05 RPM | 60 .34 RPM |
| SRP017611_kidney | 0 .06 RPM | 133 .12 RPM |
| SRP017611_liver | 0 .00 RPM | 59 .35 RPM |
| SRP030211_testis | 0 .07 RPM | 47 .98 RPM |