RetrogeneDB ID: | retro_cfam_649 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 15:9446983..9447164(+) | ||
| Located in intron of: | ENSCAFG00000003803 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HMGN1 | ||
| Ensembl ID: | ENSCAFG00000010045 | ||
| Aliases: | None | ||
| Description: | high mobility group nucleosome binding domain 1 [Source:HGNC Symbol;Acc:4984] |
| Percent Identity: | 75.41 % |
| Parental protein coverage: | 59.41 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MPKRKVSSAEGAAKEEPKRRSARLSAKPAPAKVETKPKK-AAGKDKSSDKKVQTKGKRGAK |
| M.K.KVSS.E..AK.E.KRRS.RLSAKPAPAKV..KPK..AAGKDKSSDKKVQTKGK...K | |
| Retrocopy | MLKNKVSSTERVAKKELKRRSVRLSAKPAPAKVGMKPKR>AAGKDKSSDKKVQTKGKKRLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 79 .71 RPM |
| SRP017611_brain | 0 .00 RPM | 21 .04 RPM |
| SRP017611_kidney | 0 .00 RPM | 65 .31 RPM |
| SRP017611_liver | 0 .00 RPM | 20 .38 RPM |