RetrogeneDB ID: | retro_cfam_649 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 15:9446983..9447164(+) | ||
Located in intron of: | ENSCAFG00000003803 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HMGN1 | ||
Ensembl ID: | ENSCAFG00000010045 | ||
Aliases: | None | ||
Description: | high mobility group nucleosome binding domain 1 [Source:HGNC Symbol;Acc:4984] |
Percent Identity: | 75.41 % |
Parental protein coverage: | 59.41 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MPKRKVSSAEGAAKEEPKRRSARLSAKPAPAKVETKPKK-AAGKDKSSDKKVQTKGKRGAK |
M.K.KVSS.E..AK.E.KRRS.RLSAKPAPAKV..KPK..AAGKDKSSDKKVQTKGK...K | |
Retrocopy | MLKNKVSSTERVAKKELKRRSVRLSAKPAPAKVGMKPKR>AAGKDKSSDKKVQTKGKKRLK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 79 .71 RPM |
SRP017611_brain | 0 .00 RPM | 21 .04 RPM |
SRP017611_kidney | 0 .00 RPM | 65 .31 RPM |
SRP017611_liver | 0 .00 RPM | 20 .38 RPM |