RetrogeneDB ID: | retro_cpor_1323 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_7:47945211..47945424(+) | ||
Located in intron of: | ENSCPOG00000006439 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPG | ||
Ensembl ID: | ENSCPOG00000025022 | ||
Aliases: | None | ||
Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
Percent Identity: | 91.55 % |
Parental protein coverage: | 93.42 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | PPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALER |
PPELKKFMDKKLSLKLNGG.HVQGIL.GFDPFMNLVIDECV.M.T.GQQNNIGMVVIRGNSIIM.EALER | |
Retrocopy | PPELKKFMDKKLSLKLNGGGHVQGIL*GFDPFMNLVIDECVKMVTNGQQNNIGMVVIRGNSIIMWEALER |
Parental | V |
V | |
Retrocopy | V |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .06 RPM | 7 .13 RPM |
SRP017611_kidney | 0 .10 RPM | 15 .07 RPM |
SRP017611_liver | 0 .00 RPM | 10 .71 RPM |
SRP040447_lung | 0 .15 RPM | 14 .33 RPM |
SRP040447_skeletal_muscle | 0 .03 RPM | 10 .28 RPM |