RetrogeneDB ID: | retro_ptro_1314 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 19:14786243..14786465(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSPTRG00000041856 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSPTRG00000012029 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 94.59 % |
| Parental protein coverage: | 97.37 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML |
| MSKAHP.ELKKFMDKK.SLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV.I.GNSIIML | |
| Retrocopy | MSKAHPLELKKFMDKKFSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVEI*GNSIIML |
| Parental | EALE |
| EALE | |
| Retrocopy | EALE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .61 RPM | 6 .95 RPM |
| SRP007412_cerebellum | 0 .32 RPM | 5 .84 RPM |
| SRP007412_heart | 0 .09 RPM | 14 .17 RPM |
| SRP007412_kidney | 0 .24 RPM | 16 .58 RPM |
| SRP007412_liver | 0 .07 RPM | 15 .06 RPM |
| SRP007412_testis | 0 .11 RPM | 29 .40 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1968 |