RetrogeneDB ID: | retro_cjac_796 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 10:75167974..75168196(-) | ||
| Located in intron of: | ENSCJAG00000006480 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000019313 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 87.84 % |
| Parental protein coverage: | 97.37 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML |
| MSKAHP.ELKKFMDKKL..KLNGGR.VQGIL.GFDPFMNL.IDECVEMATSGQQNNIGMVV..GNSIIML | |
| Retrocopy | MSKAHPLELKKFMDKKL*SKLNGGRYVQGILSGFDPFMNLMIDECVEMATSGQQNNIGMVVT*GNSIIML |
| Parental | EALE |
| EAL. | |
| Retrocopy | EALD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .02 RPM | 9 .05 RPM |
| SRP051959_heart | 0 .02 RPM | 7 .89 RPM |
| SRP051959_kidney | 0 .02 RPM | 12 .20 RPM |
| SRP051959_liver | 0 .02 RPM | 9 .44 RPM |
| SRP051959_lung | 0 .02 RPM | 8 .25 RPM |
| SRP051959_lymph_node | 0 .05 RPM | 9 .00 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 8 .12 RPM |
| SRP051959_spleen | 0 .00 RPM | 9 .37 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1413 |
| Pan troglodytes | retro_ptro_967 |
| Pongo abelii | retro_pabe_1169 |