RetrogeneDB ID: | retro_cpor_531 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_18:29562639..29562863(-) | ||
| Located in intron of: | ENSCPOG00000004773 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSCPOG00000025022 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
| Percent Identity: | 60.26 % |
| Parental protein coverage: | 97.37 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | MSKAHPPELKKFMDK-KLSLKLN-GGRHVQGILRGF-DPFMNLVIDECVEMATSGQQNNIGMVVIRG-NS |
| .SKA.PPELKKFM...KLSLKLN..GRH.QG.L....D.F.NL.ID.CV.MA.SGQ..N.G..V..G... | |
| Retrocopy | LSKAYPPELKKFMER<KLSLKLN<CGRHEQGTLQEYIDLFVNLMIDDCVKMAASGQHSNTGVFVTPG>RG |
| Parental | IIMLEALE |
| I..LEALE | |
| Retrocopy | IVLLEALE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 7 .13 RPM |
| SRP017611_kidney | 0 .00 RPM | 15 .07 RPM |
| SRP017611_liver | 0 .00 RPM | 10 .71 RPM |
| SRP040447_lung | 0 .00 RPM | 14 .33 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 10 .28 RPM |