RetrogeneDB ID: | retro_pabe_318 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 1:167250664..167250912(+) | ||
| Located in intron of: | ENSPPYG00000001286 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL36 | ||
| Ensembl ID: | ENSPPYG00000009431 | ||
| Aliases: | None | ||
| Description: | 60S ribosomal protein L36 [Source:UniProtKB/Swiss-Prot;Acc:Q5RAZ9] |
| Percent Identity: | 51.19 % |
| Parental protein coverage: | 78.1 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | PMAVGLNKGHKVTK-NVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPY-ERRAMELLKVSKDKRALKFI |
| P...G...G.........KPRH......LTKHTK.V.DMI.EVC.FA.Y......EL..VSKDK.ALKFI | |
| Retrocopy | PQGFGSQQGQQGDQEHEQKPRHCHCFRHLTKHTKLVWDMI*EVCCFATY<QYHTTELFQVSKDKQALKFI |
| Parental | KKRVGTHIRAKRKR |
| KKRV..HI...R.R | |
| Retrocopy | KKRVRSHIHTNRER |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 32 .23 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 22 .37 RPM |
| SRP007412_heart | 0 .00 RPM | 21 .13 RPM |
| SRP007412_kidney | 0 .00 RPM | 80 .91 RPM |
| SRP007412_liver | 0 .00 RPM | 81 .92 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_396 |