RetrogeneDB ID:

retro_mmus_455

Retrocopy
location
Organism:Mouse (Mus musculus)
Coordinates:1:71493930..71494179(-)
Located in intron of:None
Retrocopy
information
Ensembl ID:None
Aliases:None
Status:NOVEL
Parental gene
information
Parental gene summary:
Parental gene symbol:Acp1
Ensembl ID:ENSMUSG00000044573
Aliases:Acp1, 4632432E04Rik, AI427468, Acp-1, LMW-PTP
Description:acid phosphatase 1, soluble [Source:MGI Symbol;Acc:MGI:87881]


Retrocopy-Parental alignment summary:






>retro_mmus_455
ATGGCAGAGGTCGGCTCCAAGTCAGTGCTGTTCGTGTGTCTCGGTAACATTTGCCGGTCACCCATTGCAGAAGCAGGATT
CAGGAAACTGGTAACTGATGAAAAGGTTTCAGGTAATTGGGCCATTGACAGCAGCGCCGTTTCCGACTGGAACGTGGGCC
GGCCCCCAGACCCAAGAGCTGTCAGCTGCCTAAGAAATCGTGGCATTAGCACAGCCCATAAGGCAAGACAGATTACAAAA
GAAGACTTT

ORF - retro_mmus_455 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
Percent Identity: 96.39 %
Parental protein coverage: 52.53 %
Number of stop codons detected: 0
Number of frameshifts detected: 0


Retrocopy - Parental Gene Alignment:

ParentalMAEVGSKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGIS
MAEVGSKSVLFVCLGNICRSPIAEA.FRKLVTDEKVS.NWAIDSSAVSDWNVGRPPDPRAVSCLRN.GIS
RetrocopyMAEVGSKSVLFVCLGNICRSPIAEAGFRKLVTDEKVSGNWAIDSSAVSDWNVGRPPDPRAVSCLRNRGIS
ParentalTAHKARQITKEDF
TAHKARQITKEDF
RetrocopyTAHKARQITKEDF

Legend:
*Stop codon
>Forward frameshift by one nucleotide
<Reverse frameshift by one nucleotide






(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)

Expression validation based on RNA-Seq data:
Library Retrocopy expression Parental gene expression
SRP007412_brain 0 .00 RPM 16 .31 RPM
SRP007412_cerebellum 0 .00 RPM 4 .86 RPM
SRP007412_heart 0 .00 RPM 10 .06 RPM
SRP007412_kidney 0 .00 RPM 11 .45 RPM
SRP007412_liver 0 .00 RPM 19 .03 RPM
SRP007412_testis 0 .00 RPM 11 .53 RPM
RNA Polymerase II activity near the 5' end of retro_mmus_455 was not detected
No EST(s) were mapped for retro_mmus_455 retrocopy.
No TSS is located nearby retro_mmus_455 retrocopy 5' end.
retro_mmus_455 was not experimentally validated.

Retrocopy orthology:
Retrocopy retro_mmus_455 has 0 orthologous retrocopies within eutheria group .


Parental genes homology:
Parental genes homology involve 25 parental genes, and 250 retrocopies.

Species Parental gene accession Retrocopies number
Ailuropoda melanoleuca ENSAMEG000000095542 retrocopies
Bos taurus ENSBTAG000000204984 retrocopies
Choloepus hoffmanni ENSCHOG0000000389194 retrocopies
retro_chof_1010, retro_chof_1053, retro_chof_1073, retro_chof_1099, retro_chof_1100, retro_chof_1144, retro_chof_119, retro_chof_1190, retro_chof_121, retro_chof_1259, retro_chof_1265, retro_chof_1275, retro_chof_1330, retro_chof_1351, retro_chof_1359, retro_chof_1389, retro_chof_1390, retro_chof_1412, retro_chof_142, retro_chof_1444, retro_chof_1447, retro_chof_1508, retro_chof_1567, retro_chof_1570, retro_chof_1593, retro_chof_1632, retro_chof_1633, retro_chof_1658, retro_chof_1684, retro_chof_169, retro_chof_1698, retro_chof_17, retro_chof_1716, retro_chof_174, retro_chof_1799, retro_chof_1802, retro_chof_1815, retro_chof_1833, retro_chof_1838, retro_chof_1864, retro_chof_1941, retro_chof_1956, retro_chof_1993, retro_chof_2012, retro_chof_2041, retro_chof_2044, retro_chof_2091, retro_chof_2165, retro_chof_2192, retro_chof_2208, retro_chof_2228, retro_chof_2259, retro_chof_2344, retro_chof_2378, retro_chof_2384, retro_chof_2443, retro_chof_245, retro_chof_2478, retro_chof_2512, retro_chof_2532, retro_chof_2542, retro_chof_2551, retro_chof_261, retro_chof_262, retro_chof_2622, retro_chof_2636, retro_chof_2643, retro_chof_2653, retro_chof_2654, retro_chof_2678, retro_chof_2701, retro_chof_2705, retro_chof_2707, retro_chof_319, retro_chof_377, retro_chof_460, retro_chof_598, retro_chof_603, retro_chof_649, retro_chof_650, retro_chof_66, retro_chof_727, retro_chof_80, retro_chof_803, retro_chof_83, retro_chof_842, retro_chof_934, retro_chof_939, retro_chof_958, retro_chof_962, retro_chof_986, retro_chof_991, retro_chof_994, retro_chof_999,
Callithrix jacchus ENSCJAG000000116635 retrocopies
Dasypus novemcinctus ENSDNOG0000001738232 retrocopies
Equus caballus ENSECAG000000100791 retrocopy
Echinops telfairi ENSETEG0000001376418 retrocopies
Felis catus ENSFCAG000000267171 retrocopy
Homo sapiens ENSG000001437275 retrocopies
Gorilla gorilla ENSGGOG000000155775 retrocopies
Loxodonta africana ENSLAFG000000029664 retrocopies
Macropus eugenii ENSMEUG000000107333 retrocopies
Myotis lucifugus ENSMLUG000000177074 retrocopies
Macaca mulatta ENSMMUG000000170972 retrocopies
Monodelphis domestica ENSMODG000000257643 retrocopies
Mustela putorius furoENSMPUG000000127872 retrocopies
Mus musculus ENSMUSG00000044573 11 retrocopies
Nomascus leucogenys ENSNLEG000000083596 retrocopies
Oryctolagus cuniculus ENSOCUG0000001287611 retrocopies
Otolemur garnettii ENSOGAG000000003015 retrocopies
Pongo abelii ENSPPYG000000126946 retrocopies
Pan troglodytes ENSPTRG000000116055 retrocopies
Rattus norvegicus ENSRNOG0000000526011 retrocopies
Ictidomys tridecemlineatus ENSSTOG000000025203 retrocopies
Tarsius syrichta ENSTSYG000000048647 retrocopies



Copyright © RetrogeneDB 2014-2017