RetrogeneDB ID: | retro_mmus_455 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 1:71493930..71494179(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Acp1 | ||
| Ensembl ID: | ENSMUSG00000044573 | ||
| Aliases: | Acp1, 4632432E04Rik, AI427468, Acp-1, LMW-PTP | ||
| Description: | acid phosphatase 1, soluble [Source:MGI Symbol;Acc:MGI:87881] |
| Percent Identity: | 96.39 % |
| Parental protein coverage: | 52.53 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAEVGSKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGIS |
| MAEVGSKSVLFVCLGNICRSPIAEA.FRKLVTDEKVS.NWAIDSSAVSDWNVGRPPDPRAVSCLRN.GIS | |
| Retrocopy | MAEVGSKSVLFVCLGNICRSPIAEAGFRKLVTDEKVSGNWAIDSSAVSDWNVGRPPDPRAVSCLRNRGIS |
| Parental | TAHKARQITKEDF |
| TAHKARQITKEDF | |
| Retrocopy | TAHKARQITKEDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 16 .31 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 4 .86 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .06 RPM |
| SRP007412_kidney | 0 .00 RPM | 11 .45 RPM |
| SRP007412_liver | 0 .00 RPM | 19 .03 RPM |
| SRP007412_testis | 0 .00 RPM | 11 .53 RPM |