RetrogeneDB ID: | retro_ptro_3141 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | X:84920284..84920503(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2D2 | ||
Ensembl ID: | ENSPTRG00000017303 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 69.33 % |
Parental protein coverage: | 51.02 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT |
MALK.IHKE...LARDP...CSAGPV.DDM.HWQATI..PNDS.Y.GGVFFL...FP.DY.FKPPK..FT | |
Retrocopy | MALKLIHKEFLELARDPQPHCSAGPVWDDMLHWQATITRPNDSSYLGGVFFL--KFPSDYLFKPPKIKFT |
Parental | TRIYH |
..I.H | |
Retrocopy | NGICH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 60 .20 RPM |
SRP007412_cerebellum | 0 .00 RPM | 56 .00 RPM |
SRP007412_heart | 0 .00 RPM | 46 .87 RPM |
SRP007412_kidney | 0 .00 RPM | 52 .33 RPM |
SRP007412_liver | 0 .00 RPM | 48 .87 RPM |
SRP007412_testis | 3 .79 RPM | 226 .89 RPM |