RetrogeneDB ID: | retro_pabe_2724 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 5:38229940..38230333(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CBX3 | ||
Ensembl ID: | ENSPPYG00000017714 | ||
Aliases: | None | ||
Description: | Chromobox protein homolog 3 [Source:UniProtKB/Swiss-Prot;Acc:Q5R6X7] |
Percent Identity: | 64.03 % |
Parental protein coverage: | 74.86 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 2 |
Parental | EAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKS |
.AEPEEFVVEKVLD..VVNGKV..FL.WKGF.DA..TWEPEE...C.EL.E.F.NSQK....K...K.K. | |
Retrocopy | DAEPEEFVVEKVLDQCVVNGKVQHFLMWKGFIDAESTWEPEET*ACQELLETF-NSQKSC*RKR*YKKKI |
Parental | LSDSESDDSKSKKKRDAADKPRGFARGLDPER-IIGATDSSGELMFLMKWK-DSDEADLVLAKEANMKC |
.....SD..KSKK.R.AADKP....R.LDPE..IIG..DSSGEL..LMKWK..SD..DLVLAKE.NMKC | |
Retrocopy | FT*-QSDNIKSKKERGAADKP----RDLDPEK>IIGCADSSGELIILMKWK<NSDKVDLVLAKEENMKC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .22 RPM | 35 .05 RPM |
SRP007412_cerebellum | 0 .49 RPM | 54 .60 RPM |
SRP007412_heart | 0 .03 RPM | 29 .92 RPM |
SRP007412_kidney | 0 .50 RPM | 36 .53 RPM |
SRP007412_liver | 0 .21 RPM | 25 .25 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002897 | 11 retrocopies | |
Callithrix jacchus | ENSCJAG00000007952 | 8 retrocopies | |
Dipodomys ordii | ENSDORG00000005487 | 11 retrocopies | |
Loxodonta africana | ENSLAFG00000006907 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000007591 | 2 retrocopies | |
Mus musculus | ENSMUSG00000029836 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016583 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000011713 | 9 retrocopies | |
Pongo abelii | ENSPPYG00000004599 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000008891 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000017714 | 10 retrocopies |
retro_pabe_2112, retro_pabe_2243, retro_pabe_2724 , retro_pabe_2770, retro_pabe_2997, retro_pabe_3608, retro_pabe_758, retro_pabe_786, retro_pabe_892, retro_pabe_951,
|
Rattus norvegicus | ENSRNOG00000011814 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000017913 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000016711 | 4 retrocopies |